Recombinant Human NARS2 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q96I59

Gene Name: NARS2

Expression System: Escherichia coli

Molecular Weight: 12.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 78%

Start Site: Arg31

End Site: Asn120

Coverage: 0.22

Isoelectric Point: 10

Core Sequence: RDALGAQNASGERIKIQGWIRSVRSQKEVLFLHVNDGSSLESLQVVADSGLDSRELNFGSSVEVQGQLIKSPSKRQNVELKAEKIKVIGN

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 78%, Pig - 88%, Cynomolgus monkey - 91%

Alternative gene names: /

Alternative protein names: Probable asparagine--tRNA ligase; mitochondrial; Asparaginyl-tRNA synthetase; AsnRS

Protein name: asparaginyl-tRNA synthetase 2, mitochondrial

Full length: 477 amino acids

Entry name: SYNM_HUMAN

Product panel: Enzyme

• SKU: ASBPP-357-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-357-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 79731