Recombinant Human NBL1 Protein

Recombinant Human NBL1 Protein
SKU
ASBPP-3012-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: P41271

Gene Name: NBL1

Expression System: Escherichia coli

Molecular Weight: 30.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: N-SUMO & C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 94%

Start Site: Ala17

End Site: Asp181

Coverage: 1.00

Isoelectric Point: 5.5

Core Sequence: AAPPPINKLALFPDKSAWCEAKNITQIVGHSGCEAKSIQNRACLGQCFSYSVPNTFPQSTESLVHCDSCMPAQSMWEIVTLECPGHEEVPRVDKLVEKILHCSCQACGKEPSHEGLSVYVQGEDGPGSQPGTHPHPHPHPHPGGQTPEPEDPPGAPHTEEEGAED

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 94%, Rat - 93%, Pig - 94%

Alternative gene names: DAN; DAND1

Alternative protein names: Neuroblastoma suppressor of tumorigenicity 1; DAN domain family member 1; Protein N03; Zinc finger protein DAN

Protein name: NBL1, DAN family BMP antagonist

Full length: 181 amino acids

Entry name: NBL1_HUMAN
More Information
SKU ASBPP-3012-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3012-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 4681
Product information (PDF)
×
MSDS (PDF)
×