Recombinant Human NCKAP1L Protein

Note: Dry Ice fees will be extra-charged

Uniprot: P55160

Gene Name: NCKAP1L

Expression System: Escherichia coli

Molecular Weight: 13.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 93%

Start Site: Glu581

End Site: Arg670

Coverage: 0.09

Isoelectric Point: 9.5

Core Sequence: EMCPEEYPHLKNHGLHHCNSFLEELAKQTSNCVLEICAEQRNLSEQLLPKHCATTISKAKNKKTRKQRQTPRKGEPERDKPGAESHRKNR

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 93%, Rat - 61%, Pig - 99%, Cynomolgus monkey - 98%

Alternative gene names: HEM1

Alternative protein names: Nck-associated protein 1-like; Hematopoietic protein 1; Membrane-associated protein HEM-1

Protein name: NCK associated protein 1 like

Full length: 1127 amino acids

Entry name: NCKPL_HUMAN

• SKU: ASBPP-3124-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3124-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 3071