Recombinant Human NCR1 Protein

Recombinant Human NCR1 Protein
SKU
ASBPP-3238-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: O76036

Gene Name: NCR1

Expression System: Escherichia coli

Molecular Weight: 13.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 57%

Start Site: Ile31

End Site: Met120

Coverage: 0.36

Isoelectric Point: 6.5

Core Sequence: IWAEPHFMVPKEKQVTICCQGNYGAVEYQLHFEGSLFAVDRPKPPERINKVKFYIPDMNSRMAGQYSCIYRVGELWSEPSNLLDLVVTEM

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 57%, Rat - 61%, Pig - 61%, Cynomolgus monkey - 84%

Alternative gene names: LY94

Alternative protein names: Natural cytotoxicity triggering receptor 1; Lymphocyte antigen 94 homolog; NK cell-activating receptor; Natural killer cell p46-related protein; NK-p46; NKp46; hNKp46; CD antigen CD335

Protein name: natural cytotoxicity triggering receptor 1

Full length: 304 amino acids

Entry name: NCTR1_HUMAN

CD Antigen: CD335

Product panel: CD Antigen
More Information
SKU ASBPP-3238-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3238-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 9437
Product information (PDF)
×
MSDS (PDF)
×