Recombinant Human NDUFV2 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: P19404

Gene Name: NDUFV2

Expression System: Escherichia coli

Molecular Weight: 25 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 96%

Start Site: Gly33

End Site: Leu249

Coverage: 1.00

Isoelectric Point: 6.5

Core Sequence: GAGGALFVHRDTPENNPDTPFDFTPENYKRIEAIVKNYPEGHKAAAVLPVLDLAQRQNGWLPISAMNKVAEVLQVPPMRVYEVATFYTMYNRKPVGKYHIQVCTTTPCMLRNSDSILEAIQKKLGIKVGETTPDKLFTLIEVECLGACVNAPMVQINDNYYEDLTAKDIEEIIDELKAGKIPKPGPRSGRFSCEPAGGLTSLTEPPKGPGFGVQAGL

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 96%, Rat - 94%, Pig - 99%, Cynomolgus monkey - 100%

Alternative gene names: /

Alternative protein names: NADH dehydrogenase [ubiquinone] flavoprotein 2; mitochondrial; NADH-ubiquinone oxidoreductase 24 kDa subunit

Protein name: NADH:ubiquinone oxidoreductase core subunit V2

Full length: 249 amino acids

Entry name: NDUV2_HUMAN

Product panel: Enzyme

• SKU: ASBPP-4095-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-4095-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 4729