Recombinant Human NEK7 Protein

Recombinant Human NEK7 Protein
SKU
ASBPP-3974-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q8TDX7

Gene Name: NEK7

Expression System: Escherichia coli

Molecular Weight: 35.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 98%

Start Site: Met1

End Site: Ser302

Coverage: 1.00

Isoelectric Point: 8

Core Sequence: MDEQSQGMQGPPVPQFQPQKALRPDMGYNTLANFRIEKKIGRGQFSEVYRAACLLDGVPVALKKVQIFDLMDAKARADCIKEIDLLKQLNHPNVIKYYASFIEDNELNIVLELADAGDLSRMIKHFKKQKRLIPERTVWKYFVQLCSALEHMHSRRVMHRDIKPANVFITATGVVKLGDLGLGRFFSSKTTAAHSLVGTPYYMSPERIHENGYNFKSDIWSLGCLLYEMAALQSPFYGDKMNLYSLCKKIEQCDYPPLPSDHYSEELRQLVNMCINPDPEKRPDVTYVYDVAKRMHACTASS

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 98%, Rat - 98%

Alternative gene names: /

Alternative protein names: Serine/threonine-protein kinase Nek7; Never in mitosis A-related kinase 7; NimA-related protein kinase 7

Protein name: NIMA related kinase 7

Full length: 302 amino acids

Entry name: NEK7_HUMAN

Product panel: Enzyme
More Information
SKU ASBPP-3974-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3974-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 140609
Product information (PDF)
×
MSDS (PDF)
×