Recombinant Human NETO2 Protein

Recombinant Human NETO2 Protein
SKU
ASBPP-3169-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q8NC67

Gene Name: NETO2

Expression System: Escherichia coli

Molecular Weight: 28.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: N-SUMO & C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 97%

Start Site: Asp31

End Site: Pro160

Coverage: 0.27

Isoelectric Point: 6

Core Sequence: DGQNIGIKHIPATQCGIWVRTSNGGHFASPNYPDSYPPNKECIYILEAAPRQRIELTFDEHYYIEPSFECRFDHLEVRDGPFGFSPLIDRYCGVKSPPLIRSTGRFMWIKFSSDEELEGLGFRAKYSFIP

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 97%, Rat - 97%, Pig - 99%, Cynomolgus monkey - 100%

Alternative gene names: BTCL2

Alternative protein names: Neuropilin and tolloid-like protein 2; Brain-specific transmembrane protein containing 2 CUB and 1 LDL-receptor class A domains protein 2

Protein name: neuropilin and tolloid like 2

Full length: 525 amino acids

Entry name: NETO2_HUMAN
More Information
SKU ASBPP-3169-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3169-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 81831
Product information (PDF)
×
MSDS (PDF)
×