Recombinant Human NEUROD4 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9HD90

Gene Name: NEUROD4

Expression System: Escherichia coli

Molecular Weight: 20.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 93%

Start Site: Val31

End Site: Ser190

Coverage: 0.51

Isoelectric Point: 8.5

Core Sequence: VKEEESRPGTYGMLSSLTEEHDSIEEEEEEEEDGEKPKRRGPKKKKMTKARLERFRARRVKANARERTRMHGLNDALDNLRRVMPCYSKTQKLSKIETLRLARNYIWALSEVLETGQTPEGKGFVEMLCKGLSQPTSNLVAGCLQLGPQSVLLEKHEDKS

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 93%, Rat - 75%, Pig - 95%, Cynomolgus monkey - 99%

Alternative gene names: ATH3; ATOH3; BHLHA4

Alternative protein names: Neurogenic differentiation factor 4; NeuroD4; Class A basic helix-loop-helix protein 4; bHLHa4; Protein atonal homolog 3; ATH-3; Atoh3

Protein name: neuronal differentiation 4

Full length: 331 amino acids

Entry name: NDF4_HUMAN

Product panel: DNA binding & Chromatin

• SKU: ASBPP-10402-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-10402-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 58158