Recombinant Human NFASC Protein

Note: Dry Ice fees will be extra-charged

Uniprot: O94856

Gene Name: NFASC

Expression System: Escherichia coli

Molecular Weight: 11.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 100%

Start Site: Ser1241

End Site: Gly1330

Coverage: 0.07

Isoelectric Point: 4.5

Core Sequence: SRGGKYPVREKKDVPLGPEDPKEEDGSFDYSDEDNKPLQGSQTSLDGTIKQQESDDSLVDYGEGGEGQFNEDGSFIGQYTVKKDKEETEG

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 100%, Rat - 99%, Pig - 100%, Cynomolgus monkey - 100%

Alternative gene names: KIAA0756

Alternative protein names: Neurofascin

Protein name: neurofascin

Full length: 1347 amino acids

Entry name: NFASC_HUMAN

• SKU: ASBPP-038-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-038-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 23114