Recombinant Human NFIX Protein

Recombinant Human NFIX Protein
SKU
ASBPP-3480-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q14938

Gene Name: NFIX

Expression System: Escherichia coli

Molecular Weight: 11.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 99%

Start Site: Pro251

End Site: Ser340

Coverage: 0.19

Isoelectric Point: 7

Core Sequence: PSYYNINQVTLGRRSITSPPSTSTTKRPKSIDDSEMESPVDDVFYPGTGRSPAAGSSQSSGWPNDVDAGPASLKKSGKLDFCSALSSQGS

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 99%, Pig - 100%, Cynomolgus monkey - 100%

Alternative gene names: /

Alternative protein names: Nuclear factor 1 X-type; NF1-X; Nuclear factor 1/X; CCAAT-box-binding transcription factor; CTF; Nuclear factor I/X; NF-I/X; NFI-X; TGGCA-binding protein

Protein name: nuclear factor I X

Full length: 502 amino acids

Entry name: NFIX_HUMAN

Product panel: DNA binding & Chromatin
More Information
SKU ASBPP-3480-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3480-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 4784
Product information (PDF)
×
MSDS (PDF)
×