Recombinant Human NFRKB Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q6P4R8

Gene Name: NFRKB

Expression System: Escherichia coli

Molecular Weight: 13 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 95%

Start Site: Pro181

End Site: His270

Coverage: 0.07

Isoelectric Point: 8

Core Sequence: PEEREWRTQQRYLKVLREVKEECGDTALSSDEEDLSSWLPSSPARSPSPAVPLRVVPTLSTTDMKTADKVELGDSDLKIMLKKHHEKRKH

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 95%, Pig - 98%, Cynomolgus monkey - 99%

Alternative gene names: INO80G

Alternative protein names: Nuclear factor related to kappa-B-binding protein; DNA-binding protein R kappa-B; INO80 complex subunit G

Protein name: nuclear factor related to kappaB binding protein

Full length: 1299 amino acids

Entry name: NFRKB_HUMAN

Product panel: DNA binding & Chromatin

• SKU: ASBPP-10438-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-10438-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 4798