Recombinant Human NFXL1 Protein

Recombinant Human NFXL1 Protein
SKU
ASBPP-3727-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q6ZNB6

Gene Name: NFXL1

Expression System: Escherichia coli

Molecular Weight: 14 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Start Site: Leu761

End Site: Phe860

Coverage: 0.12

Isoelectric Point: 8.5

Core Sequence: LLSCCKNQCPKELPCGHRCKEMCHPGECPFNCNQKVKLRCPCKRIKKELQCNKVRENQVSIECDTTCKEMKRKASEIKEAEAKAALEEEKRRQQAELEAF

Homologies: Highest protein sequence identity to the following orthologs: Pig - 98%, Cynomolgus monkey - 98%

Alternative gene names: OZFP

Alternative protein names: NF-X1-type zinc finger protein NFXL1; Ovarian zinc finger protein; hOZFP

Protein name: nuclear transcription factor, X-box binding like 1

Full length: 911 amino acids

Entry name: NFXL1_HUMAN

Product panel: E3 Ligase,DNA binding & Chromatin
More Information
SKU ASBPP-3727-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3727-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 152518
Product information (PDF)
×
MSDS (PDF)
×