Recombinant Human NKX1-2 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9UD57

Gene Name: NKX1-2

Expression System: Escherichia coli

Molecular Weight: 22.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 71%

Start Site: Ser61

End Site: Gly250

Coverage: 0.65

Isoelectric Point: 9

Core Sequence: SRDPVRQLETPDAAGPGAGQASPLEGSEAEEEEDAEDPRRPRLRERAARLLPGLARSPDAPAGALASGEPCEDGGGGPVRSPPGSPGSPRPRRRRLEPNCAKPRRARTAFTYEQLVALENKFRATRYLSVCERLNLALSLSLTETQVKIWFQNRRTKWKKQNPGADGAAQVGGGAPQPGAAGGGGGGGSG

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 71%, Rat - 64%, Pig - 68%, Cynomolgus monkey - 93%

Alternative gene names: C10orf121; NKX1.1

Alternative protein names: NK1 transcription factor-related protein 2; Homeobox protein SAX-1; NKX-1.1

Protein name: NK1 homeobox 2

Full length: 310 amino acids

Entry name: NKX12_HUMAN

Product panel: DNA binding & Chromatin

• SKU: ASBPP-3262-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3262-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 390010