Recombinant Human NKX2-3 Protein

Recombinant Human NKX2-3 Protein
SKU
ASBPP-4185-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q8TAU0

Gene Name: NKX2-3

Expression System: Escherichia coli

Molecular Weight: 16 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 84%

Start Site: Glu21

End Site: Ser140

Coverage: 0.36

Isoelectric Point: 5.5

Core Sequence: EQQHQHFHGAHLQADLEHHFHSAPCMLAAAEGTQFSDGGEEDEEDEGEKLSYLNSLAAADGHGDSGLCPQGYVHTVLRDSCSEPKEHEEEPEVVRDRSQKSCQLKKSLETAGDCKAAEES

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 84%, Pig - 91%, Cynomolgus monkey - 96%

Alternative gene names: NKX23; NKX2C

Alternative protein names: Homeobox protein Nkx-2.3; Homeobox protein NK-2 homolog C

Protein name: NK2 homeobox 3

Full length: 364 amino acids

Entry name: NKX23_HUMAN

Product panel: DNA binding & Chromatin
More Information
SKU ASBPP-4185-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-4185-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 159296
Product information (PDF)
×
MSDS (PDF)
×