Recombinant Human NKX2-8 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: O15522

Gene Name: NKX2-8

Expression System: Escherichia coli

Molecular Weight: 18.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 75%

Start Site: Val11

End Site: Ser150

Coverage: 0.63

Isoelectric Point: 10

Core Sequence: VRSLLDLPEQDAQHLPRREPEPRAPQPDPCAAWLDSERGHYPSSDESSLETSPPDSSQRPSARPASPGSDAEKRKKRRVLFSKAQTLELERRFRQQRYLSAPEREQLASLLRLTPTQVKIWFQNHRYKLKRARAPGAAES

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 75%, Rat - 81%, Pig - 88%, Cynomolgus monkey - 97%

Alternative gene names: NKX-2.8; NKX2G; NKX2H

Alternative protein names: Homeobox protein Nkx-2.8; Homeobox protein NK-2 homolog H

Protein name: NK2 homeobox 8

Full length: 239 amino acids

Entry name: NKX28_HUMAN

Product panel: DNA binding & Chromatin

• SKU: ASBPP-10412-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-10412-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 26257