Recombinant Human NKX6-1 Protein

Recombinant Human NKX6-1 Protein
SKU
ASBPP-3246-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: P78426

Gene Name: NKX6-1

Expression System: Escherichia coli

Molecular Weight: 12 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 97%

Start Site: Tyr271

End Site: Ser350

Coverage: 0.25

Isoelectric Point: 9

Core Sequence: YSLGMTESQVKVWFQNRRTKWRKKHAAEMATAKKKQDSETERLKGASENEEEDDDYNKPLDPNSDDEKITQLLKKHKSSS

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 97%, Rat - 97%, Pig - 99%, Cynomolgus monkey - 98%

Alternative gene names: NKX6A

Alternative protein names: Homeobox protein Nkx-6.1; Homeobox protein NK-6 homolog A

Protein name: NK6 homeobox 1

Full length: 367 amino acids

Entry name: NKX61_HUMAN

Product panel: Neuroscience Biomarkers,DNA binding & Chromatin
More Information
SKU ASBPP-3246-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3246-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 4825
Product information (PDF)
×
MSDS (PDF)
×