Recombinant Human NLRP6 Protein

Recombinant Human NLRP6 Protein
SKU
ASBPP-4269-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: P59044

Gene Name: NLRP6

Expression System: Escherichia coli

Molecular Weight: 91 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: N-MBP & C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 75%

Start Site: Gln201

End Site: Glu620

Coverage: 0.48

Isoelectric Point: 5.5

Core Sequence: QGPAGIGKTMAAKKILYDWAAGKLYQGQVDFAFFMPCGELLERPGTRSLADLILDQCPDRGAPVPQMLAQPQRLLFILDGADELPALGGPEAAPCTDPFEAASGARVLGGLLSKALLPTALLLVTTRAAAPGRLQGRLCSPQCAEVRGFSDKDKKKYFYKYFRDERRAERAYRFVKENETLFALCFVPFVCWIVCTVLRQQLELGRDLSRTSKTTTSVYLLFITSVLSSAPVADGPRLQGDLRNLCRLAREGVLGRRAQFAEKELEQLELRGSKVQTLFLSKKELPGVLETEVTYQFIDQSFQEFLAALSYLLEDGGVPRTAAGGVGTLLRGDAQPHSHLVLTTRFLFGLLSAERMRDIERHFGCMVSERVKQEALRWVQGQGQGCPGVAPEVTEGAKGLEDTEEPEEEEEGEEPNYPLE

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 75%, Rat - 76%, Pig - 83%, Cynomolgus monkey - 97%

Alternative gene names: NALP6; PYPAF5

Alternative protein names: NACHT; LRR and PYD domains-containing protein 6; Angiotensin II/vasopressin receptor; PYRIN-containing APAF1-like protein 5

Protein name: NLR family pyrin domain containing 6

Full length: 892 amino acids

Entry name: NLRP6_HUMAN
More Information
SKU ASBPP-4269-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-4269-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 171389
Product information (PDF)
×
MSDS (PDF)
×