Recombinant Human NLRP7 Protein

Recombinant Human NLRP7 Protein
SKU
ASBPP-3719-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q8WX94

Gene Name: NLRP7

Expression System: Escherichia coli

Molecular Weight: 15 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Start Site: Gln11

End Site: Lys120

Coverage: 0.12

Isoelectric Point: 4

Core Sequence: QTLLEQLNEDELKSFKSLLWAFPLEDVLQKTPWSEVEEADGKKLAEILVNTSSENWIRNATVNILEEMNLTELCKMAKAEMMEDGQVQEIDNPELGDAEEDSELAKPGEK

Homologies: Highest protein sequence identity to the following orthologs: Pig - 38%, Cynomolgus monkey - 89%

Alternative gene names: NALP7; NOD12; PYPAF3

Alternative protein names: NACHT; LRR and PYD domains-containing protein 7; Nucleotide-binding oligomerization domain protein 12; PYRIN-containing APAF1-like protein 3

Protein name: NLR family pyrin domain containing 7

Full length: 980 amino acids

Entry name: NALP7_HUMAN
More Information
SKU ASBPP-3719-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3719-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 199713
Product information (PDF)
×
MSDS (PDF)
×