Recombinant Human NNMT Protein

Note: Dry Ice fees will be extra-charged

Uniprot: P40261

Gene Name: NNMT

Expression System: Escherichia coli

Molecular Weight: 30.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 85%

Start Site: Met1

End Site: Leu264

Coverage: 1.00

Isoelectric Point: 6.5

Core Sequence: MESGFTSKDTYLSHFNPRDYLEKYYKFGSRHSAESQILKHLLKNLFKIFCLDGVKGDLLIDIGSGPTIYQLLSACESFKEIVVTDYSDQNLQELEKWLKKEPEAFDWSPVVTYVCDLEGNRVKGPEKEEKLRQAVKQVLKCDVTQSQPLGAVPLPPADCVLSTLCLDAACPDLPTYCRALRNLGSLLKPGGFLVIMDALKSSYYMIGEQKFSSLPLGREAVEAAVKEAGYTIEWFEVISQSYSSTMANNEGLFSLVARKLSRPL

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 85%, Rat - 40%, Pig - 89%, Cynomolgus monkey - 97%

Alternative gene names: /

Alternative protein names: Nicotinamide N-methyltransferase

Protein name: nicotinamide N-methyltransferase

Full length: 264 amino acids

Entry name: NNMT_HUMAN

Product panel: Enzyme

• SKU: ASBPP-3947-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3947-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 4837