Recombinant Human NOC3L Protein

Recombinant Human NOC3L Protein
SKU
ASBPP-10370-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q8WTT2

Gene Name: NOC3L

Expression System: Escherichia coli

Molecular Weight: 25 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 84%

Start Site: Gln51

End Site: Val250

Coverage: 0.25

Isoelectric Point: 5

Core Sequence: QAVKDAVSKKPIPLENPKEKRPGKRIEREEEEEEEALPLDMMDEDDLQLMKDLGQRVSFLTRDLSSSEPVHAKKRKHERIIDKYEKIPRTLQTAPEKELIHLLPIKDKSGIIPQTREKPVTDSNKDEEDQEEERELEEEIIEDPIQELTIEEHLIERKKKLQEKKMHIAALASAILSDPENNIKKLKELRSMLMEQDPDV

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 84%, Pig - 92%, Cynomolgus monkey - 97%

Alternative gene names: AD24; C10orf117; FAD24

Alternative protein names: Nucleolar complex protein 3 homolog; NOC3 protein homolog; Factor for adipocyte differentiation 24; NOC3-like protein; Nucleolar complex-associated protein 3-like protein

Protein name: NOC3 like DNA replication regulator

Full length: 800 amino acids

Entry name: NOC3L_HUMAN

Product panel: DNA binding & Chromatin
More Information
SKU ASBPP-10370-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-10370-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 64318
Product information (PDF)
×
MSDS (PDF)
×