Recombinant Human NOP16 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9Y3C1

Gene Name: NOP16

Expression System: Escherichia coli

Molecular Weight: 19 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 92%

Start Site: Ala31

End Site: Leu170

Coverage: 0.84

Isoelectric Point: 9.5

Core Sequence: APRIECSHIRHAWDHAKSVRQNLAEMGLAVDPNRAVPLRKRKVKAMEVDIEERPKELVRKPYVLNDLEAEASLPEKKGNTLSRDLIDYVRYMVENHGEDYKAMARDEKNYYQDTPKQIRSKINVYKRFYPAEWQDFLDSL

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 92%, Rat - 92%, Pig - 93%, Cynomolgus monkey - 98%

Alternative gene names: /

Alternative protein names: Nucleolar protein 16; HBV pre-S2 trans-regulated protein 3

Protein name: NOP16 nucleolar protein

Full length: 178 amino acids

Entry name: NOP16_HUMAN

• SKU: ASBPP-3140-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3140-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 51491