Recombinant Human NPAP1 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9NZP6

Gene Name: NPAP1

Expression System: Escherichia coli

Molecular Weight: 37 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Start Site: Ala651

End Site: Gly990

Coverage: 0.30

Isoelectric Point: 8

Core Sequence: APDGQPQKASLPSACVFLSLPIIPPPDTSTLVNSASTASSSKPPIETNAMHTTPPSKAVILQSASVSKKYLPFYLGLPGSGNTQPSGNTASVQGSTSLPAQSVRAPATASNHPLNPGATPQPKFGAPDGPQQKTSLPSAHDFLSLPIMVPPDTSTLVSSASAASLSKPAIDTSDMNTTPPSKTVILQSTFVSRKEEYIRFYMGLPGSGNTLHSDSIASAQVSTSFPAQADRRPTTTSSHPLNTGSISHSTLGATDGQQKSDSSFILGNPATPAPVIGLTSPSVQPLSGSIIPPGFAELTSPYTALGTPVNAEPVEGHNASAFPNGTAKTSGFRIATGMPG

Homologies: Highest protein sequence identity to the following orthologs: Pig - 39%, Cynomolgus monkey - 88%

Alternative gene names: C15orf2

Alternative protein names: Nuclear pore-associated protein 1

Protein name: nuclear pore associated protein 1

Full length: 1156 amino acids

Entry name: NPAP1_HUMAN

• SKU: ASBPP-3024-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3024-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 23742