Recombinant Human NPM1 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: P06748

Gene Name: NPM1

Expression System: Escherichia coli

Molecular Weight: 14 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 99%

Start Site: Cys21

End Site: Glu130

Coverage: 0.39

Isoelectric Point: 4.5

Core Sequence: CELKADKDYHFKVDNDENEHQLSLRTVSLGAGAKDELHIVEAEAMNYEGSPIKVTLATLKMSVQPTVSLGGFEITPPVVLRLKCGSGPVHISGQHLVAVEEDAESEDEEE

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 99%, Rat - 99%, Pig - 100%, Cynomolgus monkey - 100%

Alternative gene names: NPM

Alternative protein names: Nucleophosmin; NPM; Nucleolar phosphoprotein B23; Nucleolar protein NO38; Numatrin

Protein name: nucleophosmin 1

Full length: 294 amino acids

Entry name: NPM_HUMAN

Product panel: DNA binding & Chromatin

• SKU: ASBPP-105-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-105-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 4869