Recombinant Human NPPC Protein

Note: Dry Ice fees will be extra-charged

Uniprot: P23582

Gene Name: NPPC

Expression System: Escherichia coli

Molecular Weight: 23 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: N-SUMO & N-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 91%

Start Site: Val31

End Site: Ser120

Coverage: 0.81

Isoelectric Point: 10

Core Sequence: VPRTPPAEELAEPQAAGGGQKKGDKAPGGGGANLKGDRSRLLRDLRVDTKSRAAWARLLQEHPNARKYKGANKKGLSKGCFGLKLDRIGS

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 91%, Rat - 94%, Pig - 95%, Cynomolgus monkey - 98%

Alternative gene names: CNP2

Alternative protein names: C-type natriuretic peptide [Cleaved into: CNP-22; CNP-29; CNP-53]

Protein name: natriuretic peptide C

Full length: 126 amino acids

Entry name: ANFC_HUMAN

• SKU: ASBPP-3255-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3255-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 4880