Recombinant Human NR2C1 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: P13056

Gene Name: NR2C1

Expression System: Escherichia coli

Molecular Weight: 15 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 82%

Start Site: Asp181

End Site: Ser300

Coverage: 0.21

Isoelectric Point: 6

Core Sequence: DSVQCERKPIEVSREKSSNCAASTEKIYIRKDLRSPLTATPTFVTDSESTRSTGLLDSGMFMNIHPSGVKTESAVLMTSDKAESCQGDLSTLANVVTSLANLGKTKDLSQNSNEMSMIES

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 82%, Rat - 82%, Pig - 91%, Cynomolgus monkey - 97%

Alternative gene names: TR2

Alternative protein names: Nuclear receptor subfamily 2 group C member 1; Orphan nuclear receptor TR2; Testicular receptor 2

Protein name: nuclear receptor subfamily 2 group C member 1

Full length: 603 amino acids

Entry name: NR2C1_HUMAN

Product panel: DNA binding & Chromatin

• SKU: ASBPP-10392-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-10392-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 7181