Recombinant Human NR2F1 Protein

Recombinant Human NR2F1 Protein
SKU
ASBPP-3675-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: P10589

Gene Name: NR2F1

Expression System: Escherichia coli

Molecular Weight: 12.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 99%

Start Site: Pro61

End Site: Arg160

Coverage: 0.24

Isoelectric Point: 10

Core Sequence: PATPGTAGDKGQGPPGSGQSQQHIECVVCGDKSSGKHYGQFTCEGCKSFFKRSVRRNLTYTCRANRNCPIDQHHRNQCQYCRLKKCLKVGMRREAVQRGR

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 99%, Rat - 98%, Pig - 100%, Cynomolgus monkey - 100%

Alternative gene names: EAR3; ERBAL3; TFCOUP1

Alternative protein names: COUP transcription factor 1; COUP-TF1; COUP transcription factor I; COUP-TF I; Nuclear receptor subfamily 2 group F member 1; V-erbA-related protein 3; EAR-3

Protein name: nuclear receptor subfamily 2 group F member 1

Full length: 423 amino acids

Entry name: COT1_HUMAN

Product panel: DNA binding & Chromatin
More Information
SKU ASBPP-3675-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3675-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 7025
Product information (PDF)
×
MSDS (PDF)
×