Recombinant Human NR2F6 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: P10588

Gene Name: NR2F6

Expression System: Escherichia coli

Molecular Weight: 14 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 97%

Start Site: Ala21

End Site: Gly120

Coverage: 0.29

Isoelectric Point: 8

Core Sequence: AGGYPRAAEDDSASPPGAASDAEPGDEERPGLQVDCVVCGDKSSGKHYGVFTCEGCKSFFKRSIRRNLSYTCRSNRDCQIDQHHRNQCQYCRLKKCFRVG

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 97%, Rat - 96%, Pig - 99%, Cynomolgus monkey - 64%

Alternative gene names: EAR2; ERBAL2

Alternative protein names: Nuclear receptor subfamily 2 group F member 6; V-erbA-related protein 2; EAR-2

Protein name: nuclear receptor subfamily 2 group F member 6

Full length: 404 amino acids

Entry name: NR2F6_HUMAN

Product panel: DNA binding & Chromatin

• SKU: ASBPP-3526-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3526-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 2063