Recombinant Human NR3C1 Protein

Recombinant Human NR3C1 Protein
SKU
ASBPP-4356-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: P04150

Gene Name: NR3C1

Expression System: Escherichia coli

Molecular Weight: 19.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 85%

Start Site: Asp101

End Site: Asn260

Coverage: 0.22

Isoelectric Point: 4.5

Core Sequence: DLGFPQQGQISLSSGETDLKLLEESIANLNRSTSVPENPKSSASTAVSAAPTEKEFPKTHSDVSSEQQHLKGQTGTNGGNVKLYTTDQSTFDILQDLEFSSGSPGKETNESPWRSDLLIDENCLLSPLAGEDDSFLLEGNSNEDCKPLILPDTKPKIKDN

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 85%, Rat - 85%, Pig - 83%, Cynomolgus monkey - 97%

Alternative gene names: GRL

Alternative protein names: Glucocorticoid receptor; GR; Nuclear receptor subfamily 3 group C member 1

Protein name: nuclear receptor subfamily 3 group C member 1

Full length: 777 amino acids

Entry name: GCR_HUMAN

Product panel: DNA binding & Chromatin
More Information
SKU ASBPP-4356-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-4356-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 2908
Product information (PDF)
×
MSDS (PDF)
×