Recombinant Human NRDE2 Protein

Recombinant Human NRDE2 Protein
SKU
ASBPP-3359-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q9H7Z3

Gene Name: NRDE2

Expression System: Escherichia coli

Molecular Weight: 13.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 68%

Start Site: Pro121

End Site: Val220

Coverage: 0.09

Isoelectric Point: 8.5

Core Sequence: PSRGVGGSKKESEEPNQGNNAAADTGHRFVWLEDIQAVTGETFRTDKKPDPANWEYKSLYRGDIARYKRKGDSCLGINPKKQCISWEGTSTEKKHSRKQV

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 68%, Pig - 85%, Cynomolgus monkey - 97%

Alternative gene names: C14orf102

Alternative protein names: Nuclear exosome regulator NRDE2; Protein NRDE2 homolog

Protein name: NRDE-2, necessary for RNA interference, domain containing

Full length: 1164 amino acids

Entry name: NRDE2_HUMAN

Product panel: DNA binding & Chromatin
More Information
SKU ASBPP-3359-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3359-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 55051
Product information (PDF)
×
MSDS (PDF)
×