Recombinant Human NTHL1 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: P78549

Gene Name: NTHL1

Expression System: Escherichia coli

Molecular Weight: 10.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 72%

Start Site: Ser51

End Site: Asp120

Coverage: 0.28

Isoelectric Point: 9

Core Sequence: SHSPVKRPRKAQRLRVAYEGSDSEKGEGAEPLKVPVWEPQDWQQQLVNIRAMRNKKDAPVDHLGTEHCYD

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 72%, Pig - 70%, Cynomolgus monkey - 93%

Alternative gene names: NTH1; OCTS3

Alternative protein names: Endonuclease III-like protein 1; hNTH1; Bifunctional DNA N-glycosylase/DNA-(apurinic or apyrimidinic site) lyase; DNA glycosylase/AP lyase

Protein name: nth like DNA glycosylase 1

Full length: 312 amino acids

Entry name: NTH_HUMAN

Product panel: DNA binding & Chromatin,Enzyme

• SKU: ASBPP-3240-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3240-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 4913