Recombinant Human NTMT2 Protein

Recombinant Human NTMT2 Protein
SKU
ASBPP-3282-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q5VVY1

Gene Name: NTMT2

Expression System: Escherichia coli

Molecular Weight: 21.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 92%

Start Site: Ile91

End Site: Glu260

Coverage: 0.65

Isoelectric Point: 6

Core Sequence: IELSSPDIQASQKFLRKFVGGPGRAGTDCALDCGSGIGRVSKHVLLPVFNSVELVDMMESFLLEAQNYLQVKGDKVESYHCYSLQEFTPPFRRYDVIWIQWVSGHLTDKDLLAFLSRCRDGLKENGIIILKDNVAREGCILDLSDSSVTRDMDILRSLIRKSGLVVLGQE

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 92%, Rat - 91%, Pig - 92%, Cynomolgus monkey - 97%

Alternative gene names: C1orf184; METTL11B; NRMT2

Alternative protein names: N-terminal Xaa-Pro-Lys N-methyltransferase 2; Alpha N-terminal protein methyltransferase 1B; Methyltransferase-like protein 11B; X-Pro-Lys N-terminal protein methyltransferase 1B; NTM1B

Protein name: N-terminal Xaa-Pro-Lys N-methyltransferase 2

Full length: 283 amino acids

Entry name: NTM1B_HUMAN

Product panel: Enzyme
More Information
SKU ASBPP-3282-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3282-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 149281
Product information (PDF)
×
MSDS (PDF)
×