Recombinant Human NUB1 Protein

Recombinant Human NUB1 Protein
SKU
ASBPP-1036-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q9Y5A7

Gene Name: NUB1

Expression System: Escherichia coli

Molecular Weight: 13 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 86%

Start Site: Thr141

End Site: Arg230

Coverage: 0.16

Isoelectric Point: 8

Core Sequence: TLEEQGVAHNVKAMVLELKQSEEDARKNFQLEEEEQNEAKLKEKQIQRTKRGLEILAKRAAETVVDPEMTPYLDIANQTGRSIRIPPSER

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 86%, Pig - 89%, Cynomolgus monkey - 96%

Alternative gene names: NYREN18

Alternative protein names: NEDD8 ultimate buster 1; Negative regulator of ubiquitin-like proteins 1; Renal carcinoma antigen NY-REN-18

Protein name: negative regulator of ubiquitin like proteins 1

Full length: 615 amino acids

Entry name: NUB1_HUMAN
More Information
SKU ASBPP-1036-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-1036-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 51667
Product information (PDF)
×
MSDS (PDF)
×