Recombinant Human NUGGC Protein

Recombinant Human NUGGC Protein
SKU
ASBPP-3330-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q68CJ6

Gene Name: NUGGC

Expression System: Escherichia coli

Molecular Weight: 14 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 73%

Start Site: Glu161

End Site: Arg250

Coverage: 0.13

Isoelectric Point: 6

Core Sequence: EWREELKNLTKLLHRTEELSREEADAWNRDEAVEEATWKLQMIYGNGAESKNYEELLRAKPKRKIPTSRVITLKAEEAEELSIKLDPYIR

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 73%, Pig - 83%, Cynomolgus monkey - 99%

Alternative gene names: C8orf80

Alternative protein names: Nuclear GTPase SLIP-GC; Speckled-like pattern in the germinal center

Protein name: nuclear GTPase, germinal center associated

Full length: 796 amino acids

Entry name: SLIP_HUMAN

Product panel: Enzyme
More Information
SKU ASBPP-3330-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3330-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 389643
Product information (PDF)
×
MSDS (PDF)
×