Recombinant Human NUP153 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: P49790

Gene Name: NUP153

Expression System: Escherichia coli

Molecular Weight: 10.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Start Site: Asp341

End Site: Lys410

Coverage: 0.05

Isoelectric Point: 10

Core Sequence: DRSGIDITDFQAKREKVDSQYPPVQRLMTPKPVSIATNRSVYFKPSLTPSGEFRKTNQRIDNKCSTGYEK

Homologies: Highest protein sequence identity to the following orthologs: Rat - 83%, Pig - 82%, Cynomolgus monkey - 98%

Alternative gene names: /

Alternative protein names: Nuclear pore complex protein Nup153; 153 kDa nucleoporin; Nucleoporin Nup153

Protein name: nucleoporin 153

Full length: 1475 amino acids

Entry name: NU153_HUMAN

Product panel: DNA binding & Chromatin

• SKU: ASBPP-304-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-304-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 9972