Recombinant Human NUP35 Protein

Recombinant Human NUP35 Protein
SKU
ASBPP-3214-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q8NFH5

Gene Name: NUP35

Expression System: Escherichia coli

Molecular Weight: 12.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 93%

Start Site: Pro51

End Site: Leu150

Coverage: 0.34

Isoelectric Point: 11

Core Sequence: PRSISGPSVGVMEMRSPLLAGGSPPQPVVPAHKDKSGAPPVRSIYDDISSPGLGSTPLTSRRQPNISVMQSPLVGVTSTPGTGQSMFSPASIGQPRKTTL

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 93%, Rat - 95%, Pig - 96%, Cynomolgus monkey - 99%

Alternative gene names: MP44; NUP53

Alternative protein names: Nucleoporin NUP35; 35 kDa nucleoporin; Mitotic phosphoprotein 44; MP-44; Nuclear pore complex protein Nup53; Nucleoporin NUP53

Protein name: nucleoporin 35

Full length: 326 amino acids

Entry name: NUP35_HUMAN
More Information
SKU ASBPP-3214-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3214-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 129401
Product information (PDF)
×
MSDS (PDF)
×