Recombinant Human NUP37 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q8NFH4

Gene Name: NUP37

Expression System: Escherichia coli

Molecular Weight: 12 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 92%

Start Site: Ile61

End Site: Ile140

Coverage: 0.29

Isoelectric Point: 5

Core Sequence: IQYKTLRTFHHGVRVDGIAWSPETRLDSLPPVIKFCTSAADMKIRLFTSDLQDKNEYKVLEGHTDFINGLVFDPKEGQEI

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 92%, Pig - 96%, Cynomolgus monkey - 100%

Alternative gene names: /

Alternative protein names: Nucleoporin Nup37; p37; Nup107-160 subcomplex subunit Nup37

Protein name: nucleoporin 37

Full length: 326 amino acids

Entry name: NUP37_HUMAN

• SKU: ASBPP-3247-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3247-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 79023