Recombinant Human OBP2B Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9NPH6

Gene Name: OBP2B

Expression System: Escherichia coli

Molecular Weight: 19 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 43%

Start Site: Leu16

End Site: His170

Coverage: 1.00

Isoelectric Point: 8.5

Core Sequence: LSFTLEEEDITGTWYVKAMVVDKDFPEDRRPRKVSPVKVTALGGGKLEATFTFMREDRCIQKKILMRKTEEPGKYSAYGGRKLMYLQELPRRDHYIFYCKDQHHGGLLHMGKLVGRNSDTNREALEEFKKLVQRKGLSEEDIFTPLQTGSCVPEH

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 43%, Rat - 41%, Pig - 60%, Cynomolgus monkey - 46%

Alternative gene names: /

Alternative protein names: Odorant-binding protein 2b; Odorant-binding protein IIb; OBPIIb

Protein name: odorant binding protein 2B

Full length: 170 amino acids

Entry name: OBP2B_HUMAN

• SKU: ASBPP-4310-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-4310-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 29989