Recombinant Human OIP5 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: O43482

Gene Name: OIP5

Expression System: Escherichia coli

Molecular Weight: 21.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 75%

Start Site: Cys21

End Site: Lys200

Coverage: 0.82

Isoelectric Point: 6.5

Core Sequence: CGGTERAIDQASFTTSMEWDTQVVKGSSPLGPAGLGAEEPAAGPQLPSWLQPERCAVFQCAQCHAVLADSVHLAWDLSRSLGAVVFSRVTNNVVLEAPFLVGIEGSLKGSTYNLLFCGSCGIPVGFHLYSTHAALAALRGHFCLSSDKMVCYLLKTKAIVNASEMDIQNVPLSEKIAELK

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 75%, Pig - 88%

Alternative gene names: MIS18B

Alternative protein names: Protein Mis18-beta; Cancer/testis antigen 86; CT86; Opa-interacting protein 5; OIP-5

Protein name: Opa interacting protein 5

Full length: 229 amino acids

Entry name: MS18B_HUMAN

Product panel: DNA binding & Chromatin

• SKU: ASBPP-3288-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3288-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 11339