Recombinant Human OVOL1 Protein

Recombinant Human OVOL1 Protein
SKU
ASBPP-3289-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: O14753

Gene Name: OVOL1

Expression System: Escherichia coli

Molecular Weight: 11.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 99%

Start Site: Arg131

End Site: Ala210

Coverage: 0.31

Isoelectric Point: 10.5

Core Sequence: RMLNRHMKCHNDVKRHLCTYCGKGFNDTFDLKRHVRTHTGVRPYKCSLCDKAFTQRCSLESHLKKIHGVQQKYAYKERRA

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 99%, Rat - 43%, Pig - 100%

Alternative gene names: /

Alternative protein names: Putative transcription factor Ovo-like 1; hOvo1

Protein name: ovo like transcriptional repressor 1

Full length: 267 amino acids

Entry name: OVOL1_HUMAN

Product panel: DNA binding & Chromatin
More Information
SKU ASBPP-3289-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3289-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 5017
Product information (PDF)
×
MSDS (PDF)
×