Recombinant Human EBP1 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9UQ80

Gene Name: PA2G4

Expression System: Escherichia coli

Molecular Weight: 11.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 100%

Start Site: Pro181

End Site: Lys260

Coverage: 0.23

Isoelectric Point: 8.5

Core Sequence: PIEGMLSHQLKQHVIDGEKTIIQNPTDQQKKDHEKAEFEVHEVYAVDVLVSSGEGKAKDAGQRTTIYKRDPSKQYGLKMK

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 100%, Rat - 100%, Pig - 100%, Cynomolgus monkey - 100%

Alternative gene names: EBP1

Alternative protein names: Proliferation-associated protein 2G4; Cell cycle protein p38-2G4 homolog; hG4-1; ErbB3-binding protein 1

Protein name: proliferation-associated 2G4

Full length: 394 amino acids

Entry name: PA2G4_HUMAN

• SKU: ASBPP-434-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-434-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 5036