Recombinant Human PAFAH1B3 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q15102

Gene Name: PAFAH1B3

Expression System: Escherichia coli

Molecular Weight: 27 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 96%

Start Site: Met1

End Site: Pro231

Coverage: 1.00

Isoelectric Point: 7

Core Sequence: MSGEENPASKPTPVQDVQGDGRWMSLHHRFVADSKDKEPEVVFIGDSLVQLMHQCEIWRELFSPLHALNFGIGGDGTQHVLWRLENGELEHIRPKIVVVWVGTNNHGHTAEQVTGGIKAIVQLVNERQPQARVVVLGLLPRGQHPNPLREKNRQVNELVRAALAGHPRAHFLDADPGFVHSDGTISHHDMYDYLHLSRLGYTPVCRALHSLLLRLLAQDQGQGAPLLEPAP

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 96%, Rat - 96%

Alternative gene names: PAFAHG

Alternative protein names: Platelet-activating factor acetylhydrolase IB subunit alpha1; PAF acetylhydrolase 29 kDa subunit; PAF-AH 29 kDa subunit; PAF-AH subunit gamma; PAFAH subunit gamma

Protein name: platelet activating factor acetylhydrolase 1b catalytic subunit 3

Full length: 231 amino acids

Entry name: PA1B3_HUMAN

Product panel: Enzyme

• SKU: ASBPP-3966-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3966-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 5050