Note: Dry Ice fees will be extra-charged
Uniprot: Q9NZW5
Gene Name: PALS2
Expression System: Escherichia coli
Molecular Weight: 14 kDa
Purity: ≥85%
Formulation: Phosphate buffered saline
Tag: C-His
Modification: unmodified
Species: Human
Identity-Mouse (%): 99%
Start Site: Leu11
End Site: Ser110
Coverage: 0.21
Isoelectric Point: 4.5
Core Sequence: LPSSTGAEEIDLIFLKGIMENPIVKSLAKAHERLEDSKLEAVSDNNLELVNEILEDITPLINVDENVAELVGILKEPHFQSLLEAHDIVASKCYDSPPSS
Homologies: Highest protein sequence identity to the following orthologs: Mouse - 99%, Rat - 68%, Pig - 98%, Cynomolgus monkey - 100%
Alternative gene names: MPP6; VAM1
Alternative protein names: Protein PALS2; MAGUK p55 subfamily member 6; Membrane protein; palmitoylated 6; Veli-associated MAGUK 1; VAM-1
Protein name: protein associated with LIN7 2, MAGUK p55 family member
Full length: 540 amino acids
Entry name: PALS2_HUMAN
English
Deutsch
