Recombinant Human PAPOLB Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9NRJ5

Gene Name: PAPOLB

Expression System: Escherichia coli

Molecular Weight: 12.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 62%

Start Site: Thr511

End Site: Met610

Coverage: 0.17

Isoelectric Point: 7

Core Sequence: TEGRRLTDLNDSSFDLSAGCENSMSVPSSTSTMKTGPLISSSQGRNSPALAVMTASVANIQATEFSLQQVNTNESSGVALNESIPHAVSQPAISPSPKAM

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 62%, Pig - 67%, Cynomolgus monkey - 91%

Alternative gene names: PAPT

Alternative protein names: Poly(A) polymerase beta; PAP-beta; Polynucleotide adenylyltransferase beta; Testis-specific poly(A) polymerase

Protein name: poly(A) polymerase beta

Full length: 637 amino acids

Entry name: PAPOB_HUMAN

Product panel: Enzyme

• SKU: ASBPP-3038-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3038-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 56903