Recombinant Human PARP12 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9H0J9

Gene Name: PARP12

Expression System: Escherichia coli

Molecular Weight: 11 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 73%

Start Site: Phe201

End Site: Ile280

Coverage: 0.12

Isoelectric Point: 8.5

Core Sequence: FSNSENLEKLEKLGMSSDLVSRLPTIYRNAHDIKNKSSAPSRVPPLFVPQGTSERKDSSGSVSPNTLSQEEGDQICLYHI

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 73%, Pig - 76%, Cynomolgus monkey - 98%

Alternative gene names: ZC3HDC1

Alternative protein names: Protein mono-ADP-ribosyltransferase PARP12; ADP-ribosyltransferase diphtheria toxin-like 12; ARTD12; Poly [ADP-ribose] polymerase 12; PARP-12; Zinc finger CCCH domain-containing protein 1

Protein name: poly(ADP-ribose) polymerase family member 12

Full length: 701 amino acids

Entry name: PAR12_HUMAN

Product panel: Enzyme

• SKU: ASBPP-10379-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-10379-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 64761