Recombinant Human PARP16 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q8N5Y8

Gene Name: PARP16

Expression System: Escherichia coli

Molecular Weight: 32.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 93%

Start Site: Glu11

End Site: Ser280

Coverage: 0.87

Isoelectric Point: 9

Core Sequence: EAAGRDMLAADLRCSLFASALQSYKRDSVLRPFPASYARGDCKDFEALLADASKLPNLKELLQSSGDNHKRAWDLVSWILSSKVLTIHSAGKAEFEKIQKLTGAPHTPVPAPDFLFEIEYFDPANAKFYETKGERDLIYAFHGSRLENFHSIIHNGLHCHLNKTSLFGEGTYLTSDLSLALIYSPHGHGWQHSLLGPILSCVAVCEVIDHPDVKCQTKKKDSKEIDRRRARIKHSEGGDIPPKYFVVTNNQLLRVKYLLVYSQKPPKRAS

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 93%, Rat - 90%, Pig - 95%, Cynomolgus monkey - 99%

Alternative gene names: ARTD15; C15orf30

Alternative protein names: Protein mono-ADP-ribosyltransferase PARP16; ADP-ribosyltransferase diphtheria toxin-like 15; Poly [ADP-ribose] polymerase 16; PARP-16

Protein name: poly(ADP-ribose) polymerase family member 16

Full length: 322 amino acids

Entry name: PAR16_HUMAN

Product panel: Enzyme

• SKU: ASBPP-3226-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3226-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 54956