Recombinant Human PBX2 Protein

Recombinant Human PBX2 Protein
SKU
ASBPP-3284-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: P40425

Gene Name: PBX2

Expression System: Escherichia coli

Molecular Weight: 13 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 99%

Start Site: Phe251

End Site: Ser340

Coverage: 0.24

Isoelectric Point: 10

Core Sequence: FSKQATEVLNEYFYSHLSNPYPSEEAKEELAKKCGITVSQVSNWFGNKRIRYKKNIGKFQEEANIYAVKTAVSVTQGGHSRTSSPTPPSS

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 99%, Rat - 37%, Pig - 100%, Cynomolgus monkey - 100%

Alternative gene names: G17

Alternative protein names: Pre-B-cell leukemia transcription factor 2; Homeobox protein PBX2; Protein G17

Protein name: PBX homeobox 2

Full length: 430 amino acids

Entry name: PBX2_HUMAN

Product panel: DNA binding & Chromatin
More Information
SKU ASBPP-3284-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3284-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 5089
Product information (PDF)
×
MSDS (PDF)
×