Recombinant Human PCDHA5 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9Y5H7

Gene Name: PCDHA5

Expression System: Escherichia coli

Molecular Weight: 25.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 60%

Start Site: Ile141

End Site: Leu340

Coverage: 0.23

Isoelectric Point: 4.5

Core Sequence: ILESRMPDSRFPLEGASDLDIGANAQLRYRLNPNEYFDLDVKTNEEETNFLELVLRKSLDREETQEHRLLVIATDGGKPELTGTVQLLINVLDANDNAPEFDKSIYNVRLLENAPSGTLVIKLNASDADEGINKEIVYFFSNLVLDDVKSKFIINSNTGEIKVNGELDYEDYNSYEINIDAMDKSTFPLSGHCKVVVKLL

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 60%, Rat - 61%

Alternative gene names: CNRS6

Alternative protein names: Protocadherin alpha-5; PCDH-alpha-5

Protein name: protocadherin alpha 5

Full length: 936 amino acids

Entry name: PCDA5_HUMAN

• SKU: ASBPP-2985-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-2985-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 56143