Recombinant Human PCDHAC2 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9Y5I4

Gene Name: PCDHAC2

Expression System: Escherichia coli

Molecular Weight: 26 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 48%

Start Site: Tyr371

End Site: Ala590

Coverage: 0.23

Isoelectric Point: 4.5

Core Sequence: YSPVPENATPNTIVAVLSVNDQDSGPNRKVSLGLEATLPFRLNGFGNSYTLVVSGPLDRERVAVYNITVTATDGGIPQLTSLRTLKVEISDINDNPPSFLEDSYSIYIQENNLPGVLLCTVQATDPDEKENAEVTYSLLEREIQGLPVTSYVSINSASGSLYAVNSFDYEKFREFFVTVEAQDKGSPPLSSTVTANVYVVDMNDHAPHILYPTSTNSSAA

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 48%, Rat - 44%

Alternative gene names: /

Alternative protein names: Protocadherin alpha-C2; PCDH-alpha-C2

Protein name: protocadherin alpha subfamily C, 2

Full length: 1007 amino acids

Entry name: PCDC2_HUMAN

• SKU: ASBPP-2988-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-2988-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 56134