Recombinant Human PCDHB2 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9Y5E7

Gene Name: PCDHB2

Expression System: Escherichia coli

Molecular Weight: 24 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 65%

Start Site: Val251

End Site: Ala450

Coverage: 0.26

Isoelectric Point: 4.5

Core Sequence: VQIPEDSPVGSQVAIVSARDLDIGTNGEISYAFSQASEDIRKTFRLSAKSGELLLRQKLDFESIQTYTVNIQATDGGGLSGTCVVFVQVMDLNDNPPELTMSTLINQIPENLQDTLIAVFSVSDPDSGDNGRMVCSIQDDLPFFLKPSVENFYTLVISTALDRETRSEYNITITVTDFGTPRLKTEHNITVLVSDVNDNA

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 65%, Rat - 58%, Pig - 79%, Cynomolgus monkey - 70%

Alternative gene names: /

Alternative protein names: Protocadherin beta-2; PCDH-beta-2

Protein name: protocadherin beta 2

Full length: 798 amino acids

Entry name: PCDB2_HUMAN

• SKU: ASBPP-2975-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-2975-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 56133