Recombinant Human PCDHGA10 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9Y5H3

Gene Name: PCDHGA10

Expression System: Escherichia coli

Molecular Weight: 25.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 72%

Start Site: Thr361

End Site: Ala570

Coverage: 0.24

Isoelectric Point: 4

Core Sequence: TEDSPLGTVVALLNVHDLDSEQNGQVTCSILAYLPFKLEKSIDSYYRLVIHRALDREQVSSYNITVTATDGGSPPLSTEAHFMLQVADINDNPPTFSQVSYFTYIPENNARGASIFSVTALDPDSKENAQIIYSLAEDTIQGVPLSSYISINSDTGVLYALRSFDYEQFHELQMQVTASDSGDPPLSSNVSLSLFVLDQNDNAPEILYPA

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 72%, Rat - 49%, Pig - 88%, Cynomolgus monkey - 97%

Alternative gene names: /

Alternative protein names: Protocadherin gamma-A10; PCDH-gamma-A10

Protein name: protocadherin gamma subfamily A, 10

Full length: 936 amino acids

Entry name: PCDGA_HUMAN

• SKU: ASBPP-2984-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-2984-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 56106